PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_65391_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 126aa    MW: 14031.3 Da    PI: 5.2162
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_65391_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-16849447
                                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                          ++ E++  ++++++lG++ W++Ia++++ gRt++++k++w+++
  cra_locus_65391_iso_1_len_377_ver_3  8 LSQAEEKMVIELHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 49
                                         5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-22154IPR009057Homeodomain-like
PROSITE profilePS5129427.983154IPR017930Myb domain
SuperFamilySSF466892.42E-14260IPR009057Homeodomain-like
SMARTSM007171.5E-14452IPR001005SANT/Myb domain
PfamPF002496.0E-15849IPR001005SANT/Myb domain
CDDcd001679.11E-12950No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
PDLKRGLLSQ AEEKMVIELH ARLGNRWSKI AARLPGRTDN EIKNHWNTHI KKKLLKMGID  60
PVTHEPLINK EENSIDQPIP EFDQNNDQVV LENTSFTAVA TSSELDNSST SSSSASSSEN  120
SCNESX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1415455108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788709.12e-55PREDICTED: protein ODORANT1-like
RefseqXP_016453701.12e-55PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-49ODO1_PETHY; Protein ODORANT1
TrEMBLK4CNT55e-49K4CNT5_SOLLC; Uncharacterized protein
STRINGSolyc08g079270.2.12e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154